Recombinant Full Length Human MPI Protein, C-Flag-tagged
Cat.No. : | MPI-1767HFL |
Product Overview : | Recombinant Full Length Human MPI Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Phosphomannose isomerase catalyzes the interconversion of fructose-6-phosphate and mannose-6-phosphate and plays a critical role in maintaining the supply of D-mannose derivatives, which are required for most glycosylation reactions. Mutations in the MPI gene were found in patients with carbohydrate-deficient glycoprotein syndrome, type Ib. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.5 kDa |
AA Sequence : | MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKT LSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAI ALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVV EQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLK GDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKT EVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRAC CLL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | ES Cell Differentiation/IPS |
Protein Pathways : | Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | MPI mannose phosphate isomerase [ Homo sapiens (human) ] |
Official Symbol | MPI |
Synonyms | PMI; PMI1; CDG1B |
Gene ID | 4351 |
mRNA Refseq | NM_002435.3 |
Protein Refseq | NP_002426.1 |
MIM | 154550 |
UniProt ID | P34949 |
◆ Recombinant Proteins | ||
Mpi-454M | Recombinant Mouse Mpi Protein, MYC/DDK-tagged | +Inquiry |
MPI-301556H | Recombinant Human MPI protein, GST-tagged | +Inquiry |
MPI-162H | Recombinant Human MPI Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
MPI-3736R | Recombinant Rat MPI Protein | +Inquiry |
MPI-449C | Recombinant Cynomolgus Monkey MPI Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPI-4235HCL | Recombinant Human MPI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPI Products
Required fields are marked with *
My Review for All MPI Products
Required fields are marked with *
0
Inquiry Basket