Recombinant Full Length Human Motile Sperm Domain-Containing Protein 2(Mospd2) Protein, His-Tagged
Cat.No. : | RFL1124HF |
Product Overview : | Recombinant Full Length Human Motile sperm domain-containing protein 2(MOSPD2) Protein (Q8NHP6) (1-518aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-518) |
Form : | Lyophilized powder |
AA Sequence : | MAENHAQNKAKLISETRRRFEAEYVTDKSDKYDARDVERLQQDDNWVESYLSWRHNIVDE TLKMLDESFQWRKEISVNDLNESSIPRWLLEIGVIYLHGYDKEGNKLFWIRVKYHVKDQK TILDKKKLIAFWLERYAKRENGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLS KIVIFDMPWLMNAAFKIVKTWLGPEAVSLLKFTSKNEVQDYVSVEYLPPHMGGTDPFKYS YPPLVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLLKKINPTEST SKAEENEKVDSKVKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIV AFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGP AELTQFWKEVPRNKVMEHRLRCHTVESSKPNTLTLKDNAFNMSDKTSEDICLQLSRLLES NRKLEDQVQRCIWFQQLLLSLTMLLLAFVTSFFYLLYS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MOSPD2 |
Synonyms | MOSPD2; Motile sperm domain-containing protein 2 |
UniProt ID | Q8NHP6 |
◆ Recombinant Proteins | ||
SMR3B-4109H | Recombinant Human SMR3B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CXCL8-693H | Recombinant Human CXCL8 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRTDAP-1598H | Recombinant Human KRTDAP | +Inquiry |
ATP1B1-449R | Recombinant Rhesus monkey ATP1B1 Protein, His-tagged | +Inquiry |
SSP-RS11080-0510S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS11080 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINA1-8009H | Native Human Serum Alpha 1 AntiTrypsin | +Inquiry |
fH-10R | Native Rat fH Protein | +Inquiry |
PIV3-20 | Native Parainfluenza Virus Type 3 Antigen | +Inquiry |
Collagen Type IV-09H | Native Human Collagen Type IV | +Inquiry |
ELANE-8104H | Native Human Neutrophil Elastase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD2-2553HCL | Recombinant Human CD2 cell lysate | +Inquiry |
Fetal Skeletal Muscle -160H | Human Fetal Skeletal Muscle Lysate | +Inquiry |
Lymphoma-333H | Human Lymphoma Membrane Tumor Lysate | +Inquiry |
Whole Eye-78H | Human Whole Eye Tissue Lysate | +Inquiry |
XDH-265HCL | Recombinant Human XDH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MOSPD2 Products
Required fields are marked with *
My Review for All MOSPD2 Products
Required fields are marked with *
0
Inquiry Basket