Recombinant Full Length Human MORF4L1 Protein, GST-tagged

• Cat.No.: MORF4L1-6309HF
• Product Overview: Human MORF4L1 full-length ORF ( AAH22845, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 323 amino acids
• Description: MORF4L1 (Mortality Factor 4 Like 1) is a Protein Coding gene. Diseases associated with MORF4L1 include Paraneoplastic Cerebellar Degeneration. Among its related pathways are Chromatin organization and Chromatin Regulation / Acetylation. GO annotations related to this gene include chromatin binding and protein N-terminus binding. An important paralog of this gene is MORF4L2.
• Molecular Mass: 61.27 kDa
• AA Sequence: MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MORF4L1 mortality factor 4 like 1 [ Homo sapiens ]
• Official Symbol: MORF4L1
• Synonyms: MORF4L1; mortality factor 4 like 1; mortality factor 4-like protein 1; Eaf3; Esa1p associated factor 3 homolog (S. cerevisiae); HsT17725; MEAF3; MORF related gene on chromosome 15; MORFRG15; MRG15; protein MSL3-1; MORF-related gene 15 protein; Esa1p-associated factor 3 homolog; MORF-related gene on chromosome 15; transcription factor-like protein MRG15; FWP006; S863-6; MGC10631
• Gene ID: 10933
• mRNA Refseq: NM_006791
• Protein Refseq: NP_006782
• MIM: 607303
• UniProt ID: Q9UBU8