Recombinant Full Length Human MOGAT3 Protein, GST-tagged

• Cat.No.: MOGAT3-6305HF
• Product Overview: Human MOGAT3 full-length ORF ( NP_835470.1, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 341 amino acids
• Description: Acyl-CoA: monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA (Cheng et al., 2003 [PubMed 12618427]).[supplied by OMIM
• Molecular Mass: 65.1 kDa
• AA Sequence: MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQRLHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MOGAT3 monoacylglycerol O-acyltransferase 3 [ Homo sapiens ]
• Official Symbol: MOGAT3
• Synonyms: MOGAT3; monoacylglycerol O-acyltransferase 3; 2-acylglycerol O-acyltransferase 3; DC7; DGAT2L7; hDC7; acyl-CoA:monoacylglycerol acyltransferase 3; diacylglycerol O-acyltransferase candidate 7; diacylglycerol acyltransferase 2-like protein 7; acyl coenzyme A:monoacylglycerol acyltransferase 3; MGAT3; MGC119203; MGC119204
• Gene ID: 346606
• mRNA Refseq: NM_178176
• Protein Refseq: NP_835470
• MIM: 610184
• UniProt ID: Q86VF5