Recombinant Full Length Human MOGAT2 Protein, GST-tagged

• Cat.No.: MOGAT2-6304HF
• Product Overview: Human MOGAT2 full-length ORF ( AAI03879.1, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 284 amino acids
• Description: Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT; EC 2.3.1.22) and acyl-CoA:diacylglycerol acyltransferase (DGAT; see MIM 604900) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol (Yen and Farese, 2003 [PubMed 12621063]).[supplied by OMIM
• Molecular Mass: 58.7 kDa
• AA Sequence: MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGYQASGKSTLGSVGNWQGFYFGGKMAETNADSILVEIFSPFTIKIIFWCLMPKYLEKFPQRRLSDLRN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MOGAT2 monoacylglycerol O-acyltransferase 2 [ Homo sapiens ]
• Official Symbol: MOGAT2
• Synonyms: MOGAT2; monoacylglycerol O-acyltransferase 2; 2-acylglycerol O-acyltransferase 2; DGAT2L5; FLJ22644; MGAT2; hDC5; hMGAT2; acyl CoA:monoacylglycerol acyltransferase 2; acyl-CoA:monoacylglycerol acyltransferase 2; diacylglycerol O-acyltransferase candidate 5; diacylglycerol acyltransferase 2-like protein 5; MGC119183; MGC119184; MGC119185
• Gene ID: 80168
• mRNA Refseq: NM_025098
• Protein Refseq: NP_079374
• MIM: 610270
• UniProt ID: Q3SYC2