Recombinant Full Length Human MOBKL3 Protein, GST-tagged

• Cat.No.: MOBKL3-6296HF
• Product Overview: Human MOBKL3 full-length ORF ( NP_056202.2, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 225 amino acids
• Description: This gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
• Molecular Mass: 52.4 kDa
• AA Sequence: MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MOB4 MOB family member 4, phocein [ Homo sapiens (human) ]
• Official Symbol: MOBKL3
• Synonyms: MOB4; MOB family member 4, phocein; 2C4D; MOB1; MOB3; PHOCN; PREI3; CGI-95; MOBKL3; MOB-like protein phocein; MOB1, Mps One Binder kinase activator-like 3; Mps One Binder kinase activator- like 3; class II mMOB1; mob1 homolog 3; phocein, Mob-like protein; preimplantation protein 3
• Gene ID: 25843
• mRNA Refseq: NM_001100819
• Protein Refseq: NP_001094289
• MIM: 609361
• UniProt ID: Q9Y3A3