Recombinant Full Length Human MOBKL1A Protein, GST-tagged

• Cat.No.: MOBKL1A-6291HF
• Product Overview: Human MOBKL1A full-length ORF ( NP_775739.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 216 amino acids
• Description: The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. [provided by RefSeq
• Molecular Mass: 51.5 kDa
• AA Sequence: MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MOB1B MOB kinase activator 1B [ Homo sapiens (human) ]
• Official Symbol: MOBKL1A
• Synonyms: MOB1B; MATS2; MOB4A; MOBKL1A; MOB kinase activator 1B; mob1A; mob1 homolog 1A; MOB1 Mps One Binder homolog B; mps one binder kinase activator-like 1A; MOB1, Mps One Binder kinase activator-like 1A
• Gene ID: 92597
• mRNA Refseq: NM_001244766
• Protein Refseq: NP_001231695
• MIM: 609282
• UniProt ID: Q7L9L4