Recombinant Full Length Human MOB3A Protein, GST-tagged

• Cat.No.: MOB3A-6293HF
• Product Overview: Human MOBKL2A full-length ORF ( NP_570719.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 217 amino acids
• Description: MOB3A (MOB Kinase Activator 3A) is a Protein Coding gene. An important paralog of this gene is MOB3B.
• Molecular Mass: 51.9 kDa
• AA Sequence: MSNPFLKQVFNKDKTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFNRVNLIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKNFLQTVRKILSRLFRVFVHVYIHHFDRIAQMGSEAHVNTCYKHFYYFVKEFGLIDTKELEPLKEMTARMCH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MOB3A MOB kinase activator 3A [ Homo sapiens (human) ]
• Official Symbol: MOB3A
• Synonyms: MOB3A; MOB kinase activator 3A; MOB1C; moblak; MOB-LAK; MOBKL2A; MOB kinase activator 3A; MOB LAK; MOB1, Mps One Binder kinase activator-like 2A; mob1 homolog 2A; mps one binder kinase activator-like 2A
• Gene ID: 126308
• mRNA Refseq: NM_130807
• Protein Refseq: NP_570719
• UniProt ID: Q96BX8