Recombinant Full Length Human MNAT1 Protein, C-Flag-tagged
Cat.No. : | MNAT1-1637HFL |
Product Overview : | Recombinant Full Length Human MNAT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene, along with cyclin H and CDK7, forms the CDK-activating kinase (CAK) enzymatic complex. This complex activates several cyclin-associated kinases and can also associate with TFIIH to activate transcription by RNA polymerase II. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.6 kDa |
AA Sequence : | MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDK EVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKL TREQEELEEALEVERQENEQRRLFIQKEEQLQQILKRKNKQAFLDELESSDLPVALLLAQHKDRSTQLEM QLEKPKPVKPVTFSTGIKMGQHISLAPIHKLEEALYEYQPLQIETYGPHVPELEMLGRLGYLNHVRAASP QDLAGGYTSSLACHRALQDAFSGLFWQPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways : | Nucleotide excision repair |
Full Length : | Full L. |
Gene Name | MNAT1 MNAT1 component of CDK activating kinase [ Homo sapiens (human) ] |
Official Symbol | MNAT1 |
Synonyms | MAT1; TFB3; CAP35; RNF66 |
Gene ID | 4331 |
mRNA Refseq | NM_002431.4 |
Protein Refseq | NP_002422.1 |
MIM | 602659 |
UniProt ID | P51948 |
◆ Recombinant Proteins | ||
Mnat1-4102M | Recombinant Mouse Mnat1 Protein, Myc/DDK-tagged | +Inquiry |
MNAT1-1606Z | Recombinant Zebrafish MNAT1 | +Inquiry |
MNAT1-2615R | Recombinant Rhesus Macaque MNAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MNAT1-6285HF | Recombinant Full Length Human MNAT1 Protein, GST-tagged | +Inquiry |
MNAT1-9933M | Recombinant Mouse MNAT1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MNAT1-4271HCL | Recombinant Human MNAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MNAT1 Products
Required fields are marked with *
My Review for All MNAT1 Products
Required fields are marked with *
0
Inquiry Basket