Recombinant Full Length Human MMP2 Protein, C-Flag-tagged
Cat.No. : | MMP2-1611HFL |
Product Overview : | Recombinant Full Length Human MMP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the matrix metalloproteinase (MMP) gene family, that are zinc-dependent enzymes capable of cleaving components of the extracellular matrix and molecules involved in signal transduction. The protein encoded by this gene is a gelatinase A, type IV collagenase, that contains three fibronectin type II repeats in its catalytic site that allow binding of denatured type IV and V collagen and elastin. Unlike most MMP family members, activation of this protein can occur on the cell membrane. This enzyme can be activated extracellularly by proteases, or, intracellulary by its S-glutathiolation with no requirement for proteolytical removal of the pro-domain. This protein is thought to be involved in multiple pathways including roles in the nervous system, endometrial menstrual breakdown, regulation of vascularization, and metastasis. Mutations in this gene have been associated with Winchester syndrome and Nodulosis-Arthropathy-Osteolysis (NAO) syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 70.9 kDa |
AA Sequence : | MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVL KDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETV DDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDD ELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALF TMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCV FPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKD RFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLG LPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSY FFKGAYYLKLENQSLKSVKFGSIKSDWLGCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Protein Pathways : | Bladder cancer, GnRH signaling pathway, Leukocyte transendothelial migration, Pathways in cancer |
Full Length : | Full L. |
Gene Name | MMP2 matrix metallopeptidase 2 [ Homo sapiens (human) ] |
Official Symbol | MMP2 |
Synonyms | CLG4; MONA; CLG4A; MMP-2; TBE-1; MMP-II |
Gene ID | 4313 |
mRNA Refseq | NM_004530.6 |
Protein Refseq | NP_004521.1 |
MIM | 120360 |
UniProt ID | P08253 |
◆ Recombinant Proteins | ||
MMP2-1715H | Active Recombinant Human Matrix Metallopeptidase 2 (Gelatinase A, 72 KDa Gelatinase, 72 KDa Type IV Collagenase) | +Inquiry |
MMP2-0391M | Active Recombinant Mouse MMP2 protein, His-tagged | +Inquiry |
MMP2-6516HF | Recombinant Full Length Human MMP2 Protein, GST-tagged | +Inquiry |
MMP2-5990C | Recombinant Chicken MMP2 | +Inquiry |
Mmp2-44M | Recombinant Mouse MMP-2/TIMP-2 Complex | +Inquiry |
◆ Native Proteins | ||
MMP2-8455M | Native Mouse MMP2 | +Inquiry |
MMP2-29475TH | Native Human MMP2 | +Inquiry |
MMP2-47H | Native Human MMP-2/TIMP-2 Complex | +Inquiry |
MMP2-46H | Native Human MMP-2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP2-2380HCL | Recombinant Human MMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MMP2 Products
Required fields are marked with *
My Review for All MMP2 Products
Required fields are marked with *
0
Inquiry Basket