Recombinant Full Length Human MLLT6 Protein, GST-tagged

• Cat.No.: MLLT6-6366HF
• Product Overview: Human MLLT6 full-length ORF ( AAH07237, 1 a.a. - 462 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 462 amino acids
• Description: MLLT6 (MLLT6, PHD Finger Containing) is a Protein Coding gene. Diseases associated with MLLT6 include Myeloid/Lymphoid Or Mixed Lineage Leukemia and Leukemia, Acute Myeloid. An important paralog of this gene is MLLT10.
• Molecular Mass: 76.56 kDa
• AA Sequence: MGAVNPLLSQAESSHTEPDLEDCSFRCRGTSPQESLSSMSPISSLPALFDQTASAPCGGGQLDPAAPGTTNMEQLLEKQGDGEAGVNIVEMLKALHALQKENQRLQEQILSLTAKKERLQILNVQLSVPFPALPAALPAANGPVPGPYGLPPQAGSSDSLSTSKSPPGKSSLGLDNSLSTSSEDPHSGCPSRSSSSLSFHSTPPPLPLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLNGLLGGLNGAAAPNPASLSQAGGAPTLQLPGCLNSLTEQQRHLLQQQEQQLQQLQQLLASPQLTPEHQTVVYQMIQQIQQKRELQRLQMAGGSQLPMASLLAGSSTPLLSAGTPGLLPTASAPPLLPAGALVAPSLGNNTSLMAAAAAAAAVAAAGGPPVLTAQTNPFLSLSGAEGSGGGPKGGTADKGASANQEKG
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MLLT6 myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 6 [ Homo sapiens ]
• Official Symbol: MLLT6
• Synonyms: MLLT6; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 6; myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 6; protein AF-17; AF17; FLJ23480; Myeloid/lymphoid or mixed lineage leukemia; translocated to; 6; trithorax homolog; ALL1-fused gene from chromosome 17 protein; Myeloid/lymphoid or mixed-lineage leukemia, translocated to, 6; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocated to, 6
• Gene ID: 4302
• mRNA Refseq: NM_005937
• Protein Refseq: NP_005928
• MIM: 600328
• UniProt ID: P55198