Recombinant Full Length Human MKRN2 Protein, GST-tagged
Cat.No. : | MKRN2-6345HF |
Product Overview : | Human MKRN2 full-length ORF ( NP_054879.3, 1 a.a. - 416 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 416 amino acids |
Description : | Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins (Gray et al., 2001 [PubMed 11597136]).[supplied by OMIM |
Molecular Mass : | 73.3 kDa |
AA Sequence : | MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MKRN2 makorin ring finger protein 2 [ Homo sapiens ] |
Official Symbol | MKRN2 |
Synonyms | MKRN2; makorin ring finger protein 2; probable E3 ubiquitin-protein ligase makorin-2; HSPC070; RNF62; RING finger protein 62; |
Gene ID | 23609 |
mRNA Refseq | NM_014160 |
Protein Refseq | NP_054879 |
MIM | 608426 |
UniProt ID | Q9H000 |
◆ Recombinant Proteins | ||
MKRN2-896H | Recombinant Human MKRN2, GST-tagged | +Inquiry |
Mkrn2-4086M | Recombinant Mouse Mkrn2 Protein, Myc/DDK-tagged | +Inquiry |
MKRN2-9867M | Recombinant Mouse MKRN2 Protein | +Inquiry |
MKRN2-5374H | Recombinant Human MKRN2 Protein, GST-tagged | +Inquiry |
MKRN2-9445Z | Recombinant Zebrafish MKRN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MKRN2-4299HCL | Recombinant Human MKRN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MKRN2 Products
Required fields are marked with *
My Review for All MKRN2 Products
Required fields are marked with *
0
Inquiry Basket