Recombinant Full Length Human Mitochondrial Carrier Homolog 1(Mtch1) Protein, His-Tagged
Cat.No. : | RFL34450HF |
Product Overview : | Recombinant Full Length Human Mitochondrial carrier homolog 1(MTCH1) Protein (Q9NZJ7) (1-389aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-389) |
Form : | Lyophilized powder |
AA Sequence : | MGASDPEVAPWARGGAAGMAGAGAGAGARGGAAAGVEARARDPPPAHRAHPRHPRPAAQP SARRMDGGSGGLGSGDNAPTTEALFVALGAGVTALSHPLLYVKLLIQVGHEPMPPTLGTN VLGRKVLYLPSFFTYAKYIVQVDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEIEQ VSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHPLHVISMRCMVQFVGREAKYSGVLSSI GKIFKEEGLLGFFVGLIPHLLGDVVFLWGCNLLAHFINAYLVDDSVSDTPGGLGNDQNPG SQFSQALAIRSYTKFVMGIAVSMLTYPFLLVGDLMAVNNCGLQAGLPPYSPVFKSWIHCW KYLSVQGQLFRGSSLLFRRVSSGSCFALE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MTCH1 |
Synonyms | MTCH1; PSAP; CGI-64; UNQ1871/PRO4314; Mitochondrial carrier homolog 1; Presenilin-associated protein |
UniProt ID | Q9NZJ7 |
◆ Recombinant Proteins | ||
Spike-038V | Recombinant 2019-nCoV Spike RBD(K417T, E484K, N501Y) Protein, rFc-tagged | +Inquiry |
Ear-3643R | Recombinant Rat Ear, GST-tagged | +Inquiry |
DVL3-28353TH | Recombinant Human DVL3 | +Inquiry |
FLT1-379R | Recombinant Rhesus macaque FLT1 protein, Mouse IgG2a Fc-tagged, low endotoxin | +Inquiry |
RAB8A-3150C | Recombinant Chicken RAB8A | +Inquiry |
◆ Native Proteins | ||
Lectin-1782G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Biotinylated | +Inquiry |
Collagen-225B | Native Bovine Type IV Collagen Protein | +Inquiry |
GGT1-371P | Native Porcine Gamma-Glutamyltransferase 1 | +Inquiry |
Hb-001H | Native Human Hb Protein | +Inquiry |
Troponin C-085B | Native Bovine Troponin C Protein, Sepharose CL 4B attached | +Inquiry |
◆ Cell & Tissue Lysates | ||
PVR-2272RCL | Recombinant Rat PVR cell lysate | +Inquiry |
SLCO1A2-1691HCL | Recombinant Human SLCO1A2 293 Cell Lysate | +Inquiry |
COLGALT2-482HCL | Recombinant Human COLGALT2 cell lysate | +Inquiry |
PRDM1-2890HCL | Recombinant Human PR domain containing 1 cell lysate, transcript variant 2 | +Inquiry |
GALNT9-6033HCL | Recombinant Human GALNT9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTCH1 Products
Required fields are marked with *
My Review for All MTCH1 Products
Required fields are marked with *
0
Inquiry Basket