Recombinant Full Length Human MGST1 Protein
Cat.No. : | MGST1-305HF |
Product Overview : | Recombinant full length Human Microsomal Glutathione S-transferase 1 with a N terminal proprietary tag; predicted MW: 42.79 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 155 amino acids |
Description : | The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Four transcript variants of this gene encode one protein isoform. |
Form : | Liquid |
Molecular Mass : | 42.790kDa inclusive of tags |
AA Sequence : | MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLT RKVFANPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDL ENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA YLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | MGST1 microsomal glutathione S-transferase 1 [ Homo sapiens ] |
Official Symbol | MGST1 |
Synonyms | MGST1; microsomal glutathione S-transferase 1; GST12; MGST I |
Gene ID | 4257 |
mRNA Refseq | NM_020300 |
Protein Refseq | NP_064696 |
MIM | 138330 |
UniProt ID | P10620 |
◆ Cell & Tissue Lysates | ||
MGST1-1110HCL | Recombinant Human MGST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MGST1 Products
Required fields are marked with *
My Review for All MGST1 Products
Required fields are marked with *
0
Inquiry Basket