Recombinant Full Length Human MFAP2 Protein, C-Flag-tagged

• Cat.No.: MFAP2-1395HFL
• Product Overview: Recombinant Full Length Human MFAP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 18.9 kDa
• AA Sequence: MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQV QQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRT
  VCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Secreted Protein
• Full Length: Full L.

Gene Information

• Gene Name: MFAP2 microfibril associated protein 2 [ Homo sapiens (human) ]
• Official Symbol: MFAP2
• Synonyms: MAGP; MAGP1; MAGP-1
• Gene ID: 4237
• mRNA Refseq: NM_017459.3
• Protein Refseq: NP_059453.1
• MIM: 156790
• UniProt ID: P55001