Recombinant Full Length Human METTL3 Protein, C-Flag-tagged
Cat.No. : | METTL3-836HFL |
Product Overview : | Recombinant Full Length Human METTL3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 64.3 kDa |
AA Sequence : | MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGGPKPSTASAVP ELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLLQKFAAQELIEVKRGLLQDDA HPTLVTYADHSKLSAMMGAVAEKKGPGEVAGTVTGQKRRAEQDSTTVAAFASSLVSGLNSSASEPAKEPA KKSRKHAASDVDLEIESLLNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGT KEECMKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPS QELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIP VLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGN PQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPD VVARFKQRYPDGIISKPKNLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | METTL3 methyltransferase 3, N6-adenosine-methyltransferase complex catalytic subunit [ Homo sapiens (human) ] |
Official Symbol | METTL3 |
Synonyms | M6A; IME4; Spo8; MT-A70; hMETTL3 |
Gene ID | 56339 |
mRNA Refseq | NM_019852.5 |
Protein Refseq | NP_062826.2 |
MIM | 612472 |
UniProt ID | Q86U44 |
◆ Recombinant Proteins | ||
S-243S | Recombinant SARS-CoV-2 S Protein, His-tagged | +Inquiry |
PLEKHB1-1920C | Recombinant Chicken PLEKHB1 | +Inquiry |
CPSF3-699HFL | Recombinant Full Length Human CPSF3 Protein, C-Flag-tagged | +Inquiry |
MCCD1-945H | Recombinant Human MCCD1 | +Inquiry |
PRDX4-3592R | Recombinant Rhesus monkey PRDX4 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Chitin-001C | Native Crawfish Chitin | +Inquiry |
KNG1-29146TH | Native Human KNG1 | +Inquiry |
CTRC-27191TH | Native Human CTRC | +Inquiry |
Lectin-1765D | Active Native Datura Stramonium Lectin Protein, Agarose bound | +Inquiry |
IgG-224M | Native Mouse Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCTN4-7039HCL | Recombinant Human DCTN4 293 Cell Lysate | +Inquiry |
GINS4-5931HCL | Recombinant Human GINS4 293 Cell Lysate | +Inquiry |
EIF3F-6661HCL | Recombinant Human EIF3F 293 Cell Lysate | +Inquiry |
TRPC6-741HCL | Recombinant Human TRPC6 293 Cell Lysate | +Inquiry |
PABPC1-1269HCL | Recombinant Human PABPC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All METTL3 Products
Required fields are marked with *
My Review for All METTL3 Products
Required fields are marked with *
0
Inquiry Basket