Recombinant Full Length Human METTL15 Protein, GST-tagged

• Cat.No.: METTL15-6156HF
• Product Overview: Human METT5D1 full-length ORF ( AAH30997.1, 1 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 212 amino acids
• Description: METTL15 (Methyltransferase Like 15) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity and rRNA (cytosine-N4-)-methyltransferase activity.
• Molecular Mass: 49.9 kDa
• AA Sequence: MAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDRDPTAYALAEHLSELYPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTPERGFSLRKDGSLDMRMDGGRSTGTCIYPKNIRGGEACQENRFSNCSGTQHLPHHQNPAACQHRCRSISSLCYLYTERLTTAIYPYCHQDFPGSSHICEQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: METTL15 methyltransferase like 15 [ Homo sapiens (human) ]
• Official Symbol: METTL15
• Synonyms: METTL15; methyltransferase like 15; METT5D1; probable methyltransferase-like protein 15; methyltransferase 5 domain containing 1; methyltransferase 5 domain-containing protein 1; probable S-adenosyl-L-methionine-dependent methyltransferase METT5D1; putative S-adenosyl-L-methionine-dependent methyltransferase METT5D1; EC 2.1.1.-
• Gene ID: 196074
• mRNA Refseq: NM_001113528
• Protein Refseq: NP_001107000
• MIM: 618711
• UniProt ID: A6NJ78