Recombinant Full Length Human MEIS2 Protein transcript variant f, C-Flag-tagged

Cat.No. : MEIS2-18HFL
Product Overview : Recombinant Full Length Human MEIS2 Protein transcript variant f, fused to Flag-tag at C-terminus, was expressed in HEK293T.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag
Description : This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene.
Form : 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol.
Molecular Mass : 41.4 kDa
AA Sequence : MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Notes : For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage : Store at -80 centigrade.
Concentration : >0.05 μg/μL as determined by microplate BCA method.
Use/Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Gene Name MEIS2 Meis homeobox 2 [ Homo sapiens (human) ]
Official Symbol MEIS2
Synonyms MEIS2; Meis homeobox 2; CPCMR; HsT18361; MRG1
Gene ID 4212
mRNA Refseq NM_002399.4 
Protein Refseq NP_002390.1
MIM 601740
UniProt ID O14770

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MEIS2 Products

Required fields are marked with *

My Review for All MEIS2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon