Recombinant Full Length Human MEIS2 Protein, GST-tagged

• Cat.No.: MEIS2-6127HF
• Product Overview: Human MEIS2 full-length ORF ( AAH01516, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 381 amino acids
• Description: This gene encodes a homeobox protein belonging to the TALE (three amino acid loop extension) family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq
• Molecular Mass: 67.65 kDa
• AA Sequence: MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MEIS2 Meis homeobox 2 [ Homo sapiens ]
• Official Symbol: MEIS2
• Synonyms: MEIS2; Meis homeobox 2; Meis (mouse) homolog 2 , Meis1, myeloid ecotropic viral integration site 1 homolog 2 (mouse); homeobox protein Meis2; HsT18361; MRG1; Meis homolog 2; Meis1-related gene 1; meis1-related protein 1; TALE homeobox protein Meis2; Meis1, myeloid ecotropic viral integration site 1 homolog 2; MGC2820
• Gene ID: 4212
• mRNA Refseq: NM_001220482
• Protein Refseq: NP_001207411
• MIM: 601740
• UniProt ID: O14770