Recombinant Full Length Human MEIOC Protein, GST-tagged

• Cat.No.: MEIOC-5045HF
• Product Overview: Human FLJ35848 full-length ORF ( NP_001028831.1, 1 a.a. - 622 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 622 amino acids
• Description: MEIOC (Meiosis Specific With Coiled-Coil Domain) is a Protein Coding gene.
• Molecular Mass: 97.2 kDa
• AA Sequence: MEKQYLRNSNLTPQQKIDELHHGFTGLDLEEQWMYPSRSDHSNCHNIQTNDTAKTTFQEYPLIKNCFTPQTGLSDIMKESGVDIYHYGRDRICTKGLEAPLQQKRAEMFLSQFNRYTENVDYCRYPEYVHPNKAKLNKCSNFSVQDSKKLANGTPETPTVEADTYTKLFQVKPANQKKMEETIPDQQNFTFPKTTPHLTEKQFAKEAVFTADFGLTSEYGLKPHTACPANDFANVTEKQQFAKPDPPHSEYFKSVNLLSNSATSSGGINLNRPTWMNVQTKNNTPIPYRNQGNLMKLNSHLSAASKGSNHSSDFPQLSSTNLTPNSNLFQKYCQENPSAFSSFDFSYSGAERIQSVNHIEGLTKPGEENLFKLVTDKKIKQPNGFCDNYSAQKYGIIENVNKHNFQAKPQSGHYDPEEGPKHLDGLSQNTYQDLLESQGHSNSHRTRGGDNSRVNRTQVSCFSNNYMMGDLRHNQCFQQLGSNGFPLRSTHPFGHSVVPLLDSYDLLSYDDLSHLYPYFNMMYGDNSFSGLMPTFGFQRPIKTRSGPASELHIRLEECCEQWRALEKERKKTELALAKNYPGKKVSSTNNTPVPRLTSNPSRVDRLIVDELRELARVSCKNR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MEIOC meiosis specific with coiled-coil domain [ Homo sapiens (human) ]
• Official Symbol: MEIOC
• Synonyms: MEIOC; meiosis specific with coiled-coil domain; C17orf104; meiosis-specific coiled-coil domain-containing protein MEIOC; meiosis-specific with coiled-coil domain protein
• Gene ID: 284071
• mRNA Refseq: NM_001145080
• Protein Refseq: NP_001138552
• MIM: 616934
• UniProt ID: A2RUB1