Recombinant Full Length Human MEF2C Protein
Cat.No. : | MEF2C-310HF |
Product Overview : | Recombinant full length Human MEF2C with N terminal proprietary tag, 77.66kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 469 amino acids |
Description : | This locus encodes a member of the MADS box transcription enhancer factor 2 (MEF2) family of proteins, which play a role in myogenesis. The encoded protein, MEF2 polypeptide C, has both trans-activating and DNA binding activities. This protein may play a role in maintaining the differentiated state of muscle cells. Mutations and deletions at this locus have been associated with severe mental retardation, stereotypic movements, epilepsy, and cerebral malformation. Alternatively spliced transcript variants have been described. |
Form : | Liquid |
Molecular Mass : | 77.660kDa inclusive of tags |
AA Sequence : | MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCD CEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEQHES RTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYR KINEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLV YSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNT GGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNK NMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDV DLLLNQRINNSQSAQSLATPVVSVATPTLPGQGMGGYP SAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQ QHLHNMQPSALSQLGACTSTHLSQSSNLSLPSTQSLNI KSEPVSPPRDRTTTPSRYPQHTRHEAGRSPVDSLSSCSSS YDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLS E |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | MEF2C myocyte enhancer factor 2C [ Homo sapiens ] |
Official Symbol | MEF2C |
Synonyms | MEF2C; myocyte enhancer factor 2C; myocyte-specific enhancer factor 2C |
Gene ID | 4208 |
mRNA Refseq | NM_001131005 |
Protein Refseq | NP_001124477 |
MIM | 600662 |
UniProt ID | Q06413 |
◆ Recombinant Proteins | ||
NGDN-6048M | Recombinant Mouse NGDN Protein, His (Fc)-Avi-tagged | +Inquiry |
RTN4-2036H | Recombinant Human RTN4 Protein, His&GST-tagged | +Inquiry |
FNTB-2378R | Recombinant Rat FNTB Protein | +Inquiry |
TFEB-8212Z | Recombinant Zebrafish TFEB | +Inquiry |
TNFSF8-13H | Recombinant Human TNFSF8 Protein (D234A), His-tagged | +Inquiry |
◆ Native Proteins | ||
CP-8073H | Native Human Plasma Ceruloplasmin | +Inquiry |
20S Immunoproteasome-224C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
ACTN3-3280C | Native Chicken ACTN3 | +Inquiry |
Serpinc1-5485M | Native Mouse Serpin (or cysteine) Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
HPIV2ag-272V | Native Parainfluenza Virus type 2(strain II ALTB cc 2056) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
UPB1-495HCL | Recombinant Human UPB1 293 Cell Lysate | +Inquiry |
PROM1-981RCL | Recombinant Rat PROM1 cell lysate | +Inquiry |
KLF10-4933HCL | Recombinant Human KLF10 293 Cell Lysate | +Inquiry |
C10orf55-8364HCL | Recombinant Human C10orf55 293 Cell Lysate | +Inquiry |
PAK7-3452HCL | Recombinant Human PAK7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MEF2C Products
Required fields are marked with *
My Review for All MEF2C Products
Required fields are marked with *
0
Inquiry Basket