Recombinant Full Length Human MED4 Protein, GST-tagged

• Cat.No.: MED4-6250HF
• Product Overview: Human MED4 full-length ORF ( AAH05189, 1 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 270 amino acids
• Description: This gene encodes a component of the Mediator complex. The Mediator complex interacts with DNA-binding gene-specific transcription factors to modulate transcription by RNA polymerase II. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
• Molecular Mass: 55.44 kDa
• AA Sequence: MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDVEIMSTDSSSSSSESD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MED4 mediator complex subunit 4 [ Homo sapiens ]
• Official Symbol: MED4
• Synonyms: MED4; mediator complex subunit 4; mediator of RNA polymerase II transcription, subunit 4 homolog (S. cerevisiae) , VDRIP, vitamin D receptor interacting protein; mediator of RNA polymerase II transcription subunit 4; DRIP36; HSPC126; TRAP36; TRAP/SMCC/PC2 subunit p36 subunit; activator-recruited cofactor 36 kDa component; mediator of RNA polymerase II transcription, subunit 4 homolog; vitamin D3 receptor-interacting protein complex 36 kDa component; ARC36; VDRIP; RP11-90M2.2; FLJ10956
• Gene ID: 29079
• mRNA Refseq: NM_014166
• Protein Refseq: NP_054885
• MIM: 605718
• UniProt ID: Q9NPJ6