Recombinant Full Length Human MED4 Protein, GST-tagged

Cat.No. : MED4-6250HF
Product Overview : Human MED4 full-length ORF ( AAH05189, 1 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 270 amino acids
Description : This gene encodes a component of the Mediator complex. The Mediator complex interacts with DNA-binding gene-specific transcription factors to modulate transcription by RNA polymerase II. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
Molecular Mass : 55.44 kDa
AA Sequence : MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDVEIMSTDSSSSSSESD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MED4 mediator complex subunit 4 [ Homo sapiens ]
Official Symbol MED4
Synonyms MED4; mediator complex subunit 4; mediator of RNA polymerase II transcription, subunit 4 homolog (S. cerevisiae) , VDRIP, vitamin D receptor interacting protein; mediator of RNA polymerase II transcription subunit 4; DRIP36; HSPC126; TRAP36; TRAP/SMCC/PC2 subunit p36 subunit; activator-recruited cofactor 36 kDa component; mediator of RNA polymerase II transcription, subunit 4 homolog; vitamin D3 receptor-interacting protein complex 36 kDa component; ARC36; VDRIP; RP11-90M2.2; FLJ10956;
Gene ID 29079
mRNA Refseq NM_014166
Protein Refseq NP_054885
MIM 605718
UniProt ID Q9NPJ6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MED4 Products

Required fields are marked with *

My Review for All MED4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon