Recombinant Full Length Human MED31 Protein, GST-tagged

• Cat.No.: MED31-6249HF
• Product Overview: Human MED31 full-length ORF ( AAH12539, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 131 amino acids
• Description: MED31 (Mediator Complex Subunit 31) is a Protein Coding gene. Among its related pathways are Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) and Gene Expression. GO annotations related to this gene include protein complex binding and RNA polymerase II transcription cofactor activity.
• Molecular Mass: 40.15 kDa
• AA Sequence: MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MED31 mediator complex subunit 31 [ Homo sapiens ]
• Official Symbol: MED31
• Synonyms: MED31; mediator complex subunit 31; mediator of RNA polymerase II transcription, subunit 31 homolog (S. cerevisiae); mediator of RNA polymerase II transcription subunit 31; CGI 125; Soh1; hSOH1; mediator complex subunit SOH1; mediator of RNA polymerase II transcription, subunit 31 homolog; CGI-125; 3110004H13Rik; FLJ27436; FLJ36714
• Gene ID: 51003
• mRNA Refseq: NM_016060
• Protein Refseq: NP_057144
• UniProt ID: Q9Y3C7