Recombinant Full Length Human MDM4 Protein
Cat.No. : | MDM4-302HF |
Product Overview : | Recombinant full length Human MDMX with N terminal proprietary tag; Predicted MWt 79.97 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 490 amino acids |
Description : | This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latters degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
Form : | Liquid |
Molecular Mass : | 79.970kDa inclusive of tags |
AA Sequence : | MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAA GAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDL LGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTL ALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLPT SEHKCIHSREDEDLIENLAQDETSRLDLGFEEWDVAGLPW WFLGNLRSNYTPRSNGSTDLQTNQDVGTAIVSDTTDDLWF LNESVSEQLGVGIKVEAADTEQTSEEVGKVSDKKVIEVGK NDDLEDSKSLSDDTDVEVTSEDEWQCTECKKFNSPSKRYC FRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVP DCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHS SESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLC EKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKE IQLVIKVFIA |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | MDM4 Mdm4 p53 binding protein homolog (mouse) [ Homo sapiens ] |
Official Symbol | MDM4 |
Synonyms | MDM4; Mdm4 p53 binding protein homolog (mouse); Mdm4, transformed 3T3 cell double minute 4, p53 binding protein (mouse) , mouse double minute 4, human homolog of; p53 binding protein; protein Mdm4; MDMX |
Gene ID | 4194 |
mRNA Refseq | NM_001204171 |
Protein Refseq | NP_001191100 |
MIM | 602704 |
UniProt ID | O15151 |
◆ Recombinant Proteins | ||
MDM4-302HF | Recombinant Full Length Human MDM4 Protein | +Inquiry |
MDM4-4386H | Recombinant Human MDM4 protein, His -tagged | +Inquiry |
MDM4-6114HF | Recombinant Full Length Human MDM4 Protein, GST-tagged | +Inquiry |
MDM4-0091H | Recombinant Human MDM4 Protein (T2-A490), His tagged | +Inquiry |
MDM4-9668M | Recombinant Mouse MDM4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDM4-4403HCL | Recombinant Human MDM4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MDM4 Products
Required fields are marked with *
My Review for All MDM4 Products
Required fields are marked with *
0
Inquiry Basket