Recombinant Full Length Human MDH2 Protein, C-Flag-tagged
Cat.No. : | MDH2-1619HFL |
Product Overview : | Recombinant Full Length Human MDH2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Several transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.3 kDa |
AA Sequence : | MLSALARPVSAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSH IETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVI ANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLIS QCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKS QETECTYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVKTLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Citrate cycle (TCA cycle), Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Pyruvate metabolism |
Full Length : | Full L. |
Gene Name | MDH2 malate dehydrogenase 2 [ Homo sapiens (human) ] |
Official Symbol | MDH2 |
Synonyms | MDH; MOR1; DEE51; M-MDH; EIEE51; MGC:3559 |
Gene ID | 4191 |
mRNA Refseq | NM_005918.4 |
Protein Refseq | NP_005909.2 |
MIM | 154100 |
UniProt ID | P40926 |
◆ Recombinant Proteins | ||
MDH2-680C | Recombinant Cynomolgus MDH2 Protein, His-tagged | +Inquiry |
MDH2-4499H | Active Recombinant Human MDH2 Protein, His-tagged | +Inquiry |
Mdh2-4004M | Recombinant Mouse Mdh2 Protein, Myc/DDK-tagged | +Inquiry |
MDH2-4525H | Recombinant Human MDH2 Protein (Ala25-Lys338), C-His tagged | +Inquiry |
MDH2-9664M | Recombinant Mouse MDH2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDH2-4407HCL | Recombinant Human MDH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MDH2 Products
Required fields are marked with *
My Review for All MDH2 Products
Required fields are marked with *
0
Inquiry Basket