Recombinant Full Length Human MAGED2 Protein, C-Flag-tagged
Cat.No. : | MAGED2-1513HFL |
Product Overview : | Recombinant Full Length Human MAGED2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the MAGED gene family. The MAGED genes are clustered on chromosome Xp11. This gene is located in Xp11.2, a hot spot for X-linked intellectual disability (XLID). Mutations in this gene cause a form of transient antenatal Bartter's syndrome. This gene may also be involved in several types of cancer, including breast cancer and melanoma. The protein encoded by this gene is progressively recruited from the cytoplasm to the nucleoplasm during the interphase and after nucleolar stress and is thus thought to play a role in cell cycle regulation. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 64.8 kDa |
AA Sequence : | MSDTSESGAGLTRFQAEASEKDSSSMMQTLLTVTQNVEVPETPKASKALEVSEDVKVSKASGVSKATEVS KTPEAREAPATQASSTTQLTDTQVLAAENKSLAADTKKQNADPQAVTMPATETKKVSHVADTKVNTKAQE TEAAPSQAPADEPEPESAAAQSQENQDTRPKVKAKKARKVKHLDGEEDGSSDQSQASGTTGGRRVSKALM ASMARRASRGPIAFWARRASRTRLAAWARRALLSLRSPKARRGKARRRAAKLQSSQEPEAPPPRDVALLQ GRANDLVKYLLAKDQTKIPIKRSDMLKDIIKEYTDVYPEIIERAGYSLEKVFGIQLKEIDKNDHLYILLS TLEPTDAGILGTTKDSPKLGLLMVLLSIIFMNGNRSSEAVIWEVLRKLGLRPGIHHSLFGDVKKLITDEF VKQKYLDYARVPNSNPPEYEFFWGLRSYYETSKMKVLKFACKVQKKDPKEWAAQYREAMEADLKAAAEAA AEAKARAEIRARMGIGLGSENAAGPCNWDEADIGPWAKARIQAGAEAKAKAQESGSASTGASTSTNNSAS ASASTSGGFSAGASLTATLTFGLFAGLGGAGASTSGSSGACGFSYKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MAGED2 MAGE family member D2 [ Homo sapiens (human) ] |
Official Symbol | MAGED2 |
Synonyms | 11B6; BCG1; BCG-1; HCA10; BARTS5; MAGE-D2 |
Gene ID | 10916 |
mRNA Refseq | NM_201222.3 |
Protein Refseq | NP_957516.1 |
MIM | 300470 |
UniProt ID | Q9UNF1 |
◆ Recombinant Proteins | ||
MAGED2-1346H | Recombinant Human MAGED2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAGED2-1513HFL | Recombinant Full Length Human MAGED2 Protein, C-Flag-tagged | +Inquiry |
MAGED2-702H | Recombinant Human MAGED2, GST-tagged | +Inquiry |
MAGED2-2449R | Recombinant Rhesus Macaque MAGED2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAGED2-2629R | Recombinant Rhesus monkey MAGED2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGED2-4539HCL | Recombinant Human MAGED2 293 Cell Lysate | +Inquiry |
MAGED2-4538HCL | Recombinant Human MAGED2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAGED2 Products
Required fields are marked with *
My Review for All MAGED2 Products
Required fields are marked with *
0
Inquiry Basket