Recombinant Full Length Human MAGEB1 Protein, C-Flag-tagged
Cat.No. : | MAGEB1-1343HFL |
Product Overview : | Recombinant Full Length Human MAGEB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is localized in the DSS (dosage-sensitive sex reversal) critical region, and expressed in testis and in a significant fraction of tumors of various histological types. This gene and other MAGEB members are clustered on chromosome Xp22-p21. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene, however, the full length nature of some variants has not been defined. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.9 kDa |
AA Sequence : | MPRGQKSKLRAREKRRKAREETQGLKVAHATAAEKEECPSSSPVLGDTPTSSPAAGIPQKPQGAPPTTT AAAAVSCTESDEGAKCQGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVV DEKYKDHFTEILNGASRRLELVFGLDLKEDNPSGHTYTLVSKLNLTNDGNLSNDWDFPRNGLLMPLLGV IFLKGNSATEEEIWKFMNVLGAYDGEEHLIYGEPRKFITQDLVQEKYLKYEQVPNSDPPRYQFLWGPRA YAETTKMKVLEFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARSRAPFSRSSH PMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MAGEB1 MAGE family member B1 [ Homo sapiens (human) ] |
Official Symbol | MAGEB1 |
Synonyms | CT3.1; DAM10; MAGEL1; MAGE-Xp |
Gene ID | 4112 |
mRNA Refseq | NM_177404.3 |
Protein Refseq | NP_796379.1 |
MIM | 300097 |
UniProt ID | P43366 |
◆ Recombinant Proteins | ||
MAGEB1-1259H | Recombinant Human MAGEB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAGEB1-6432H | Recombinant Human MAGEB1 protein, His&Myc-tagged | +Inquiry |
MAGEB1-2626R | Recombinant Rhesus monkey MAGEB1 Protein, His-tagged | +Inquiry |
MAGEB1-692H | Recombinant Human MAGEB1, GST-tagged | +Inquiry |
MAGEB1-2450H | Recombinant Human MAGEB1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGEB1-4548HCL | Recombinant Human MAGEB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAGEB1 Products
Required fields are marked with *
My Review for All MAGEB1 Products
Required fields are marked with *
0
Inquiry Basket