Recombinant Full Length Human LYZL2 Protein, GST-tagged

• Cat.No.: LYZL2-6042HF
• Product Overview: Human LYZL2 full-length ORF ( NP_898881.2, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Lysozymes (see LYZ; MIM 153450), especially C-type lysozymes, are well-recognized bacteriolytic factors widely distributed in the animal kingdom and play a mainly protective role in host defense. LYZL2 is a member of a family of lysozyme-like genes (Zhang et al., 2005 [PubMed 16014814]).[supplied by OMIM
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 48 kDa
• Protein length: 194 amino acids
• AA Sequence: MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSDWKKDCEVS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LYZL2 lysozyme-like 2 [ Homo sapiens (human) ]
• Official Symbol: LYZL2
• Synonyms: LYZL2; lysozyme-like 2; lysozyme-like protein 2; lysozyme 2; lysozyme-2; EC 3.2.1.17
• Gene ID: 119180
• mRNA Refseq: NM_183058
• Protein Refseq: NP_898881
• MIM: 612748
• UniProt ID: Q7Z4W2