Recombinant Full Length Human LYSMD4 Protein, GST-tagged

• Cat.No.: LYSMD4-6037HF
• Product Overview: Human LYSMD4 full-length ORF ( NP_689662.2, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 297 amino acids
• Description: LYSMD4 (LysM Domain Containing 4) is a Protein Coding gene. An important paralog of this gene is LYSMD3.
• Molecular Mass: 58.5 kDa
• AA Sequence: MAVGTRGTLLKKSLTVWFCGPGARSATRAVSTSLPRREQVTWCCCSGSWPRRTASTSWRCSMAANFCRHTVWLTEHGLKNEACPTKTGIDGVGFLVADIKKVNNFIREQDLYALKSVKIPVRNHGILMETHKELKPLLSPSSETTVTVELPEADRAGAGTGAQAGQLMGFFKGIDQDIERAVQSEIFLHESYCMDTSHQPLLPAPPKTPMDGADCGIQWWNAVFIMLLIGIVLPVFYLVYFKIQASGETPNSLNTTVIPNGSMAMGTVPGQAPRLAVAVPAVTSADSQFSQTTQAGS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LYSMD4 LysM, putative peptidoglycan-binding, domain containing 4 [ Homo sapiens ]
• Official Symbol: LYSMD4
• Synonyms: LYSMD4; LysM, putative peptidoglycan-binding, domain containing 4; lysM and putative peptidoglycan-binding domain-containing protein 4; FLJ33008; MGC99501
• Gene ID: 145748
• mRNA Refseq: NM_152449
• Protein Refseq: NP_689662
• UniProt ID: Q5XG99