Recombinant Full Length Human LYSMD3 Protein, GST-tagged
Cat.No. : | LYSMD3-6036HF |
Product Overview : | Human LYSMD3 full-length ORF ( AAH58027.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 127 amino acids |
Description : | LYSMD3 (LysM Domain Containing 3) is a Protein Coding gene. An important paralog of this gene is LYSMD4. |
Molecular Mass : | 40.7 kDa |
AA Sequence : | MAGRHQNRSFPLPGVQSSGQVHAFGNCSDSDILEEDAEVYELRSRGKEKVRRSTSRDRLDDIIVLTKDIQEGDTLNAIALQYCCTVYQNSSKKVQFLDRNTLSSKRKTDFTSFICSILFRTTGNFAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LYSMD3 LysM, putative peptidoglycan-binding, domain containing 3 [ Homo sapiens ] |
Official Symbol | LYSMD3 |
Synonyms | LYSMD3; LysM, putative peptidoglycan-binding, domain containing 3; |
Gene ID | 116068 |
mRNA Refseq | NM_198273 |
Protein Refseq | NP_938014 |
UniProt ID | Q7Z3D4 |
◆ Recombinant Proteins | ||
LYSMD3-6036HF | Recombinant Full Length Human LYSMD3 Protein, GST-tagged | +Inquiry |
LYSMD3-3460H | Recombinant Human LYSMD3 protein, His-tagged | +Inquiry |
LYSMD3-3522R | Recombinant Rat LYSMD3 Protein | +Inquiry |
LYSMD3-3065C | Recombinant Chicken LYSMD3 | +Inquiry |
LYSMD3-9406M | Recombinant Mouse LYSMD3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LYSMD3 Products
Required fields are marked with *
My Review for All LYSMD3 Products
Required fields are marked with *
0
Inquiry Basket