Recombinant Full Length Human LYSMD3 Protein, GST-tagged

• Cat.No.: LYSMD3-6036HF
• Product Overview: Human LYSMD3 full-length ORF ( AAH58027.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: LYSMD3 (LysM Domain Containing 3) is a Protein Coding gene. An important paralog of this gene is LYSMD4.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 40.7 kDa
• Protein length: 127 amino acids
• AA Sequence: MAGRHQNRSFPLPGVQSSGQVHAFGNCSDSDILEEDAEVYELRSRGKEKVRRSTSRDRLDDIIVLTKDIQEGDTLNAIALQYCCTVYQNSSKKVQFLDRNTLSSKRKTDFTSFICSILFRTTGNFAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LYSMD3 LysM, putative peptidoglycan-binding, domain containing 3 [ Homo sapiens ]
• Official Symbol: LYSMD3
• Synonyms: LYSMD3; LysM, putative peptidoglycan-binding, domain containing 3
• Gene ID: 116068
• mRNA Refseq: NM_198273
• Protein Refseq: NP_938014
• UniProt ID: Q7Z3D4