Recombinant Full Length Human LYPD5 Protein, GST-tagged

Cat.No. : LYPD5-6240HF
Product Overview : Human LYPD5 full-length ORF ( AAH57816, 1 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 249 amino acids
Description : LYPD5 (LY6/PLAUR Domain Containing 5) is a Protein Coding gene. Among its related pathways are Post-translational modification- synthesis of GPI-anchored proteins and Metabolism of proteins. An important paralog of this gene is LYPD3.
Molecular Mass : 53.13 kDa
AA Sequence : MGVPRVILLCLFGAALCLTGSQALQCYSFEHTYLGPFDLRAMKLPSISCPHECFEAILSLDTGYRAPVTLVRKGCWTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDPPTLSGAECYACIGVHQDDCAIGRSRRVQCHQDQTACFQGNGRMTVGNFSVPVYIRTCHRPSCTTEGSTSPWTAIDLQGSCCEGYLCNRKSMTQPFTSASATTPPRALQVLALLLPVLLLVGLSA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LYPD5 LY6/PLAUR domain containing 5 [ Homo sapiens ]
Official Symbol LYPD5
Synonyms LYPD5; LY6/PLAUR domain containing 5; ly6/PLAUR domain-containing protein 5; FLJ30469; metastasis-associated protein; PRO4356;
Gene ID 284348
mRNA Refseq NM_001031749
Protein Refseq NP_001026919
MIM 619618
UniProt ID Q6UWN5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LYPD5 Products

Required fields are marked with *

My Review for All LYPD5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon