Recombinant Full Length Human LYPD5 Protein, GST-tagged

• Cat.No.: LYPD5-6240HF
• Product Overview: Human LYPD5 full-length ORF ( AAH57816, 1 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 249 amino acids
• Description: LYPD5 (LY6/PLAUR Domain Containing 5) is a Protein Coding gene. Among its related pathways are Post-translational modification- synthesis of GPI-anchored proteins and Metabolism of proteins. An important paralog of this gene is LYPD3.
• Molecular Mass: 53.13 kDa
• AA Sequence: MGVPRVILLCLFGAALCLTGSQALQCYSFEHTYLGPFDLRAMKLPSISCPHECFEAILSLDTGYRAPVTLVRKGCWTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDPPTLSGAECYACIGVHQDDCAIGRSRRVQCHQDQTACFQGNGRMTVGNFSVPVYIRTCHRPSCTTEGSTSPWTAIDLQGSCCEGYLCNRKSMTQPFTSASATTPPRALQVLALLLPVLLLVGLSA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LYPD5 LY6/PLAUR domain containing 5 [ Homo sapiens ]
• Official Symbol: LYPD5
• Synonyms: LYPD5; LY6/PLAUR domain containing 5; ly6/PLAUR domain-containing protein 5; FLJ30469; metastasis-associated protein; PRO4356
• Gene ID: 284348
• mRNA Refseq: NM_001031749
• Protein Refseq: NP_001026919
• MIM: 619618
• UniProt ID: Q6UWN5