Recombinant Full Length Human LYPD4 Protein, GST-tagged

• Cat.No.: LYPD4-6239HF
• Product Overview: Human LYPD4 full-length ORF ( AAH34629.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 211 amino acids
• Description: LYPD4 (LY6/PLAUR Domain Containing 4) is a Protein Coding gene. Diseases associated with LYPD4 include Mitral Valve Insufficiency and Retinitis Pigmentosa 4, Autosomal Dominant Or Recessive. Among its related pathways are Post-translational modification- synthesis of GPI-anchored proteins and Metabolism of proteins. An important paralog of this gene is CD177.
• Molecular Mass: 49 kDa
• AA Sequence: MGPQHLRLVQLFCLLGAISTLPRMSCGAGCYKTQKGTARGVVGFKGCSSSSSYPAQISYLVSPPGVSIASYSRVCRSYLCNNLTNLEPFVKLKASTPKSITSASCSCPTCVGEHMKDCLPNFVTTNSCPLAASTCYSSTLKFQAGFLNTTFLLMGCAREHNQLLADFHHIGSIKVTEVLNILEKSQIVGAASSRQDPAWGVVLGLLFAFRD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LYPD4 LY6/PLAUR domain containing 4 [ Homo sapiens ]
• Official Symbol: LYPD4
• Synonyms: LYPD4; LY6/PLAUR domain containing 4; ly6/PLAUR domain-containing protein 4; MGC42718; sperm membrane receptor; SMR
• Gene ID: 147719
• mRNA Refseq: NM_173506
• Protein Refseq: NP_775777
• UniProt ID: Q6UWN0