Recombinant Full Length Human LYG1 Protein, GST-tagged
Cat.No. : | LYG1-6233HF |
Product Overview : | Human LYG1 full-length ORF ( NP_777558.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 194 amino acids |
Description : | LYG1 (Lysozyme G1) is a Protein Coding gene. GO annotations related to this gene include lysozyme activity. An important paralog of this gene is LYG2. |
Molecular Mass : | 47.8 kDa |
AA Sequence : | MSALWLLLGLLALMDLSESSNWGCYGNIQSLDTPGASCGIGRRHGLNYCGVRASERLAEIDMPYLLKYQPMMQTIGQKYCMDPAVIAGVLSRKSPGDKILVNMGDRTSMVQDPGSQAPTSWISESQVSQTTEVLTTRIKEIQRRFPTWTPDQYLRGGLCAYSGGAGYVRSSQDLSCDFCNDVLARAKYLKRHGF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LYG1 lysozyme G-like 1 [ Homo sapiens ] |
Official Symbol | LYG1 |
Synonyms | LYG1; lysozyme G-like 1; lysozyme g-like protein 1; SALW1939; |
Gene ID | 129530 |
mRNA Refseq | NM_174898 |
Protein Refseq | NP_777558 |
UniProt ID | Q8N1E2 |
◆ Recombinant Proteins | ||
LYG1-4562H | Recombinant Human LYG1 Protein, GST-tagged | +Inquiry |
LYG1-3848H | Recombinant Human LYG1 protein, His-tagged | +Inquiry |
LYG1-2347H | Recombinant Human LYG1 protein, His-tagged | +Inquiry |
LYG1-8587H | Recombinant Human LYG1, His & GST tagged | +Inquiry |
LYG1-6233HF | Recombinant Full Length Human LYG1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYG1-001HCL | Recombinant Human LYG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LYG1 Products
Required fields are marked with *
My Review for All LYG1 Products
Required fields are marked with *
0
Inquiry Basket