Recombinant Full Length Human LY6G5B Protein, GST-tagged

• Cat.No.: LY6G5B-6227HF
• Product Overview: Human LY6G5B full-length ORF ( NP_067044.2, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 201 amino acids
• Description: LY6G5B belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction (Mallya et al., 2002 [PubMed 12079290]).[supplied by OMIM
• Molecular Mass: 49 kDa
• AA Sequence: MKVHMLVGVLVMVGFTVGKVPVPDIRTCHFCLVEDPSVGCISGSEKCTISSSSLCMVITIYYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQAGLLTPHPS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LY6G5B lymphocyte antigen 6 complex, locus G5B [ Homo sapiens ]
• Official Symbol: LY6G5B
• Synonyms: LY6G5B; lymphocyte antigen 6 complex, locus G5B; C6orf19, chromosome 6 open reading frame 19; lymphocyte antigen 6 complex locus protein G5b; G5b; lymphocyte antigen-6 G5B; C6orf19
• Gene ID: 58496
• mRNA Refseq: NM_021221
• Protein Refseq: NP_067044
• MIM: 610433
• UniProt ID: Q8NDX9