Recombinant Full Length Human LURAP1 Protein, GST-tagged

• Cat.No.: LURAP1-6218HF
• Product Overview: Human LURAP1 full-length ORF ( ADZ15857.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 239 amino acids
• Description: LURAP1 (Leucine Rich Adaptor Protein 1) is a Protein Coding gene. An important paralog of this gene is LURAP1L.
• Molecular Mass: 26.3 kDa
• AA Sequence: MEGTVESQTPDLRDVEGKVGRKTPEGLLRGLRGECELGTSGALLLPGASSTGHDLGDKIMALKMELAYLRAIDVKILQQLVTLNEGIEAVRWLLEERGTLTSHCSSLTSSQYSLTGGSPGRSRRGSWDSLPDTSTTDRLDSVSIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRLGSLRAVWKPPGERLQGGPPESPEDESAKLGFEAHWFWEQCQDDVTFL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LURAP1 leucine rich adaptor protein 1 [ Homo sapiens ]
• Official Symbol: LURAP1
• Synonyms: LRP35A; LRAP35a; C1orf190; LURAP1; leucine rich adaptor protein 1
• Gene ID: 541468
• mRNA Refseq: NM_001013615
• Protein Refseq: NP_001013633
• MIM: 616129
• UniProt ID: Q96LR2