Recombinant Full Length Human LURAP1 Protein, GST-tagged
Cat.No. : | LURAP1-6218HF |
Product Overview : | Human LURAP1 full-length ORF ( ADZ15857.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | LURAP1 (Leucine Rich Adaptor Protein 1) is a Protein Coding gene. An important paralog of this gene is LURAP1L. |
Source : | In Vitro Cell Free System |
Species : | Human |
Tag : | GST |
Molecular Mass : | 26.3 kDa |
Protein length : | 239 amino acids |
AA Sequence : | MEGTVESQTPDLRDVEGKVGRKTPEGLLRGLRGECELGTSGALLLPGASSTGHDLGDKIMALKMELAYLRAIDVKILQQLVTLNEGIEAVRWLLEERGTLTSHCSSLTSSQYSLTGGSPGRSRRGSWDSLPDTSTTDRLDSVSIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRLGSLRAVWKPPGERLQGGPPESPEDESAKLGFEAHWFWEQCQDDVTFL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LURAP1 leucine rich adaptor protein 1 [ Homo sapiens ] |
Official Symbol | LURAP1 |
Synonyms | LRP35A; LRAP35a; C1orf190; LURAP1; leucine rich adaptor protein 1 |
Gene ID | 541468 |
mRNA Refseq | NM_001013615 |
Protein Refseq | NP_001013633 |
MIM | 616129 |
UniProt ID | Q96LR2 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All LURAP1 Products
Required fields are marked with *
My Review for All LURAP1 Products
Required fields are marked with *
0
Inquiry Basket