Recombinant Full Length Human LTC4S Protein, GST-tagged

• Cat.No.: LTC4S-6209HF
• Product Overview: Human LTC4S full-length ORF ( NP_665874.1, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 150 amino acids
• Description: The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum. [provided by RefSeq
• Molecular Mass: 43 kDa
• AA Sequence: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LTC4S leukotriene C4 synthase [ Homo sapiens ]
• Official Symbol: LTC4S
• Synonyms: LTC4S; leukotriene C4 synthase; MGC33147; LTC4 synthase
• Gene ID: 4056
• mRNA Refseq: NM_145867
• Protein Refseq: NP_665874
• MIM: 246530
• UniProt ID: Q16873