Recombinant Full Length Human LTB4R Protein

• Cat.No.: LTB4R-6133HF
• Product Overview: Human LTB4R full-length ORF (ABW03628.1) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• ProteinLength: 878 amino acids
• Description: LTB4R (Leukotriene B4 Receptor) is a Protein Coding gene. Among its related pathways are Immune response CCR3 signaling in eosinophils and RET signaling. GO annotations related to this gene include G-protein coupled receptor activity and leukotriene receptor activity. An important paralog of this gene is LTB4R2.
• Form: Liquid
• Molecular Mass: 38.72 kDa
• AA Sequence: MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPFKLNELN
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: LTB4R leukotriene B4 receptor [ Homo sapiens ]
• Official Symbol: LTB4R
• Synonyms: LTB4R; leukotriene B4 receptor; CMKRL1, GPR16, P2RY7; leukotriene B4 receptor 1; BLTR; LTB4R1; P2Y7; LTB4-R1; LTB4-R 1; P2Y purinoceptor 7; chemokine receptor-like 1; G protein-coupled receptor 16; G-protein coupled receptor 16; chemoattractant receptor-like 1; purinergic receptor P2Y, G-protein coupled, 7; BLT1; GPR16; LTBR1; P2RY7; CMKRL1
• Gene ID: 1241
• mRNA Refseq: NM_001143919
• Protein Refseq: NP_001137391
• MIM: 601531
• UniProt ID: Q15722