Recombinant Full Length Human LSMEM1 Protein

• Cat.No.: LSMEM1-2629HF
• Product Overview: Human LSMEM1 full-length ORF (ADR82831.1) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• ProteinLength: 294 amino acids
• Description: LSMEM1 (Leucine Rich Single-Pass Membrane Protein 1) is a Protein Coding gene.
• Form: Liquid
• Molecular Mass: 14.5 kDa
• AA Sequence: MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRSLFFVGLLIVLIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRLNQLNQLDSEQN
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: LSMEM1 leucine rich single-pass membrane protein 1 [ Homo sapiens (human) ]
• Official Symbol: LSMEM1
• Synonyms: LSMEM1; leucine rich single-pass membrane protein 1; Leucine Rich Single-Pass Membrane Protein 1; Leucine-Rich Single-Pass Membrane Protein 1; C7orf53; Chromosome 7 Open Reading Frame 53
• Gene ID: 286006
• mRNA Refseq: NM_182597
• Protein Refseq: NP_872403
• UniProt ID: Q8N8F7