Recombinant Full Length Human LRRIQ1 Protein, GST-tagged

• Cat.No.: LRRIQ1-6076HF
• Product Overview: Human LRRIQ1 full-length ORF ( AAH05399.1, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 240 amino acids
• Description: LRRIQ1 (Leucine Rich Repeats And IQ Motif Containing 1) is a Protein Coding gene.
• Molecular Mass: 54.4 kDa
• AA Sequence: MDDDDAKLKAEIEAELDKLSISSLEKEDIESDAKSETQSDDSDTDSVELPESVLHCINIIKNRSKAVEELILQDLEDILSCSYGAVSNNHMHLRTGLSTEYEESSEQLIKILSEIEKEEFMRSKTDCATPDFVPEPSPHDLPMDEHVLPDDADINFGYCEVEEKCRQSFEAWQEKQKELEDKEKQTLKAQRDREEKQFQEEEEKRHCWMKQFKVEKKKLENIQKVFCFCFSCIFKISSYL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRRIQ1 leucine-rich repeats and IQ motif containing 1 [ Homo sapiens ]
• Official Symbol: LRRIQ1
• Synonyms: LRRIQ1; leucine-rich repeats and IQ motif containing 1
• Gene ID: 84125
• mRNA Refseq: NM_001079910
• Protein Refseq: NP_001073379
• UniProt ID: Q96JM4