Recombinant Full Length Human LRRC3B Protein, GST-tagged

Cat.No. : LRRC3B-5965HF
Product Overview : Human LRRC3B full-length ORF ( NP_443185.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is a tumor suppressor, with lowered expression levels found in gastric, renal, colorectal, lung, and breast cancer tissues. The promoter of this gene is frequently hypermethylated in these cancer tissues, although the hypermethylation does not appear to be the cause of the reduced expression of this gene. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Dec 2015]
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 55.7 kDa
Protein length : 259 amino acids
AA Sequence : MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRRC3B leucine rich repeat containing 3B [ Homo sapiens ]
Official Symbol LRRC3B
Synonyms LRP15; LRRC3B; leucine rich repeat containing 3B
Gene ID 116135
mRNA Refseq NM_052953
Protein Refseq NP_443185
MIM 618996
UniProt ID Q96PB8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LRRC3B Products

Required fields are marked with *

My Review for All LRRC3B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon