Recombinant Human LRRC3B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LRRC3B-4303H |
Product Overview : | LRRC3B MS Standard C13 and N15-labeled recombinant protein (NP_443185) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a tumor suppressor, with lowered expression levels found in gastric, renal, colorectal, lung, and breast cancer tissues. The promoter of this gene is frequently hypermethylated in these cancer tissues, although the hypermethylation does not appear to be the cause of the reduced expression of this gene. Several transcript variants encoding the same protein have been found for this gene. |
Molecular Mass : | 29.3 kDa |
AA Sequence : | MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LRRC3B leucine rich repeat containing 3B [ Homo sapiens (human) ] |
Official Symbol | LRRC3B |
Synonyms | LRRC3B; leucine rich repeat containing 3B; LRP15; leucine-rich repeat-containing protein 3B; leucine-rich repeat protein 15; leucine-rich repeat protein LRP15 |
Gene ID | 116135 |
mRNA Refseq | NM_052953 |
Protein Refseq | NP_443185 |
MIM | 618996 |
UniProt ID | Q96PB8 |
◆ Recombinant Proteins | ||
LRRC3B-636H | Recombinant Human LRRC3B, GST-tagged | +Inquiry |
LRRC3B-2559R | Recombinant Rhesus monkey LRRC3B Protein, His-tagged | +Inquiry |
LRRC3B-3995H | Recombinant Human LRRC3B Protein (Cys34-Tyr204), C-His tagged | +Inquiry |
LRRC3B-4668H | Recombinant Human LRRC3B Protein, GST-tagged | +Inquiry |
LRRC3B-5609Z | Recombinant Zebrafish LRRC3B | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC3B-4631HCL | Recombinant Human LRRC3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRRC3B Products
Required fields are marked with *
My Review for All LRRC3B Products
Required fields are marked with *
0
Inquiry Basket