Recombinant Full Length Human LRRC20 Protein, GST-tagged

• Cat.No.: LRRC20-5949HF
• Product Overview: Human LRRC20 full-length ORF ( NP_997002.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 184 amino acids
• Description: LRRC20 (Leucine Rich Repeat Containing 20) is a Protein Coding gene.
• Molecular Mass: 46.9 kDa
• AA Sequence: MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANNELKSLTSKFMTTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPALETINLEENEIVDVPVEKLAAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGARAPLP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRRC20 leucine rich repeat containing 20 [ Homo sapiens ]
• Official Symbol: LRRC20
• Synonyms: LRRC20; leucine rich repeat containing 20; leucine-rich repeat-containing protein 20; FLJ10751; FLJ10844
• Gene ID: 55222
• mRNA Refseq: NM_018205
• Protein Refseq: NP_060675
• UniProt ID: Q8TCA0