Recombinant Full Length Human LRRC18 Protein, GST-tagged

• Cat.No.: LRRC18-5946HF
• Product Overview: Human LRRC18 full-length ORF ( NP_001006940.2, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 261 amino acids
• Description: LRRC18 (Leucine Rich Repeat Containing 18) is a Protein Coding gene. Diseases associated with LRRC18 include Usher Syndrome, Type Ik and Deafness, Autosomal Recessive 33. An important paralog of this gene is PIDD1.
• Molecular Mass: 56.1 kDa
• AA Sequence: MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRNLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQLKNIRAVNLGLNHLDSVSTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGESEIFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRLTSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRRC18 leucine rich repeat containing 18 [ Homo sapiens ]
• Official Symbol: LRRC18
• Synonyms: UNQ933; UNQ9338; VKGE9338; LRRC18; leucine rich repeat containing 18
• Gene ID: 474354
• mRNA Refseq: NM_001006939
• Protein Refseq: NP_001006940
• MIM: 619002
• UniProt ID: Q8N456