Recombinant Full Length Human LPGAT1 Protein, GST-tagged

Cat.No. : LPGAT1-5986HF
Product Overview : Human LPGAT1 full-length ORF ( NP_055688.1, 1 a.a. - 370 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 370 amino acids
Description : Acyl-CoA:lysophosphatidylglycerol (LPG) acyltransferase catalyzes the reacylation of LPG to phosphatidylglycerol, a membrane phospholipid that is an important precursor for the synthesis of cardiolipin (Yang et al., 2004 [PubMed 15485873]).[supplied by OMIM
Molecular Mass : 69.5 kDa
AA Sequence : MAITLEEAPWLGWLLVKALMRFAFMVVNNLVAIPSYICYVIILQPLRVLDSKRFWYIEGIMYKWLLGMVASWGWYAGYTVMEWGEDIKAVSKDEAVMLVNHQATGDVCTLMMCLQDKGLVVAQMMWLMDHIFKYTNFGIVSLVHGDFFIRQGRSYRDQQLLLLKKHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAFAKKNNLPFLTNVTLPRSGATKIILNALVAQQKNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVTHVHYRIFPIKDVPLETDDLTTWLYQRFVEKEDLLSHFYETGAFPPSKGHKEAVSREMTLSNLWIFLIQSFAFLSGYMWYNIIQYFYHCLF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LPGAT1 lysophosphatidylglycerol acyltransferase 1 [ Homo sapiens ]
Official Symbol LPGAT1
Synonyms LPGAT1; lysophosphatidylglycerol acyltransferase 1; FAM34A, family with sequence similarity 34, member A; acyl-CoA:lysophosphatidylglycerol acyltransferase 1; FAM34A1; KIAA0205; NET8; family with sequence similarity 34, member A; FAM34A;
Gene ID 9926
mRNA Refseq NM_014873
Protein Refseq NP_055688
MIM 610473
UniProt ID Q92604

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LPGAT1 Products

Required fields are marked with *

My Review for All LPGAT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon