Recombinant Full Length Human LPGAT1 Protein, GST-tagged

• Cat.No.: LPGAT1-5986HF
• Product Overview: Human LPGAT1 full-length ORF ( NP_055688.1, 1 a.a. - 370 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Acyl-CoA:lysophosphatidylglycerol (LPG) acyltransferase catalyzes the reacylation of LPG to phosphatidylglycerol, a membrane phospholipid that is an important precursor for the synthesis of cardiolipin (Yang et al., 2004 [PubMed 15485873]).[supplied by OMIM
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 69.5 kDa
• Protein length: 370 amino acids
• AA Sequence: MAITLEEAPWLGWLLVKALMRFAFMVVNNLVAIPSYICYVIILQPLRVLDSKRFWYIEGIMYKWLLGMVASWGWYAGYTVMEWGEDIKAVSKDEAVMLVNHQATGDVCTLMMCLQDKGLVVAQMMWLMDHIFKYTNFGIVSLVHGDFFIRQGRSYRDQQLLLLKKHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAFAKKNNLPFLTNVTLPRSGATKIILNALVAQQKNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVTHVHYRIFPIKDVPLETDDLTTWLYQRFVEKEDLLSHFYETGAFPPSKGHKEAVSREMTLSNLWIFLIQSFAFLSGYMWYNIIQYFYHCLF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LPGAT1 lysophosphatidylglycerol acyltransferase 1 [ Homo sapiens ]
• Official Symbol: LPGAT1
• Synonyms: LPGAT1; lysophosphatidylglycerol acyltransferase 1; FAM34A, family with sequence similarity 34, member A; acyl-CoA:lysophosphatidylglycerol acyltransferase 1; FAM34A1; KIAA0205; NET8; family with sequence similarity 34, member A; FAM34A
• Gene ID: 9926
• mRNA Refseq: NM_014873
• Protein Refseq: NP_055688
• MIM: 610473
• UniProt ID: Q92604