Recombinant Full Length Human LOC541473 Protein, GST-tagged

Cat.No. : LOC541473-4812HF
Product Overview : Human FKBP6 full-length ORF ( NP_001013770.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 131 amino acids
Description : LOC541473 (FK506 Binding Protein 6, 36kDa Pseudogene) is a Pseudogene.
Molecular Mass : 40.9 kDa
AA Sequence : MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYYGYLEHLDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMQRGELARCFVLGKLLDSQGPSLHLYLRAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LOC541473 FK506 binding protein 6, 36kDa pseudogene [ Homo sapiens (human) ]
Official Symbol LOC541473
Synonyms LOC541473; FK506 binding protein 6, 36kDa pseudogene; MGC88170; FK506 Binding Protein 6, 36kDa Pseudogene 3; AC006014.8
Gene ID 541473

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LOC541473 Products

Required fields are marked with *

My Review for All LOC541473 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon