Recombinant Full Length Human Lipid Phosphate Phosphatase-Related Protein Type 3(Lppr3) Protein, His-Tagged
Cat.No. : | RFL6676HF |
Product Overview : | Recombinant Full Length Human Lipid phosphate phosphatase-related protein type 3(LPPR3) Protein (Q6T4P5) (1-718aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-718) |
Form : | Lyophilized powder |
AA Sequence : | MISTKEKNKIPKDSMTLLPCFYFVELPIVASSIVSLYFLELTDLFKPAKVGFQCYDRTLS MPYVETNEELIPLLMLLSLAFAAPAASIMVAEGMLYCLQSRLWGRAGGPAGAEGSINAGG CNFNSFLRRTVRFVGVHVFGLCATALVTDVIQLATGYHTPFFLTVCKPNYTLLGTSCEVN PYITQDICSGHDIHAILSARKTFPSQHATLSAFAAVYVSMYFNSVISDTTKLLKPILVFA FAIAAGVCGLTQITQYRSHPVDVYAGFLIGAGIAAYLACHAVGNFQAPPAEKPAAPAPAK DALRALTQRGHDSVYQQNKSVSTDELGPPGRLEGAPRPVAREKTSLGSLKRASVDVDLLA PRSPMAKENMVTFSHTLPRASAPSLDDPARRHMTIHVPLDASRSKQLISEWKQKSLEGRG LGLPDDASPGHLRAPAEPMAEEEEEEEDEEEEEEEEEEEDEGPAPPSLYPTVQARPGLGP RVILPPRAGPPPLVHIPEEGAQTGAGLSPKSGAGVRAKWLMMAEKSGAAVANPPRLLQVI AMSKAPGAPGPKAAETASSSSASSDSSQYRSPSDRDSASIVTIDAHAPHHPVVHLSAGGA PWEWKAAGGGAKAEADGGYELGDLARGFRGGAKPPGVSPGSSVSDVDQEEPRFGAVATVN LATGEGLPPLGAADGALGPGSRESTLRRHAGGLGLAEREAEAEAEGYFRKMQARRFPD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PLPPR3 |
Synonyms | PLPPR3; LPPR3; PHP2; PRG2; Phospholipid phosphatase-related protein type 3; Lipid phosphate phosphatase-related protein type 3; PAP-2-like protein 2; Plasticity-related gene 2 protein; PRG-2 |
UniProt ID | Q6T4P5 |
◆ Recombinant Proteins | ||
MFNG-9786M | Recombinant Mouse MFNG Protein | +Inquiry |
RFL248MF | Recombinant Full Length Marinomonas Sp. Upf0060 Membrane Protein Mmwyl1_1139 (Mmwyl1_1139) Protein, His-Tagged | +Inquiry |
LY86-676H | Recombinant Human LY86 protein, His-SUMO-tagged | +Inquiry |
AQP4-394R | Recombinant Rat AQP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXL6-3909H | Recombinant Human FBXL6 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
LRG1-240H | Native Human Leucine-rich Alpha 2 Glycoprotein-1 (LRG1) | +Inquiry |
IgG-018R | Native Rabbit Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
LYZ-27700TH | Native Human LYZ | +Inquiry |
PLG-55H | Native Human lys-Plasminogen | +Inquiry |
LH-92P | Native Porcine LH | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGFR1-476HCL | Recombinant Human FGFR1 cell lysate | +Inquiry |
ICOS-1195RCL | Recombinant Rat ICOS cell lysate | +Inquiry |
SLC35A2-1734HCL | Recombinant Human SLC35A2 293 Cell Lysate | +Inquiry |
KCTD6-894HCL | Recombinant Human KCTD6 cell lysate | +Inquiry |
CDH17-2032HCL | Recombinant Human CDH17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLPPR3 Products
Required fields are marked with *
My Review for All PLPPR3 Products
Required fields are marked with *
0
Inquiry Basket