Recombinant Full Length Human LILRA3 Protein, His&Fc tagged
Cat.No. : | LILRA3-12HFL |
Product Overview : | Recombinant human LILRA3/CD85e, fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Protein Length : | 1-439 aa |
Description : | This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members of this family. It acts as a soluble receptor for class I major histocompatibility complex (MHC) antigens. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and is polymorphic in human populations, with many individuals containing a deletion of this genomic region. |
Tag : | C-His&Fc |
Form : | Liquid |
Molecular Mass : | 72.2 kDa |
AA Sequence : | < DGS> GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE< LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH> |
Endotoxin : | < 1 EU/μg of protein determined by LAL method |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
References : | 1. Jones DC., et al, (2011) Journal of Immunology. 186:2990-2997. 2. Borges L., et al,(1997) Journal of Immunology. 159:5192-5196. |
Gene Name | LILRA3 leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 [ Homo sapiens (human) ] |
Official Symbol | LILRA3 |
Synonyms | LILRA3; leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3; leukocyte immunoglobulin-like receptor subfamily A member 3; CD85e; HM31; HM43; ILT6; LIR 4; LIR4; ILT-6; immunoglobulin-like transcript 6; CD85 antigen-like family member E; leucocyte immunoglobulin-like receptor; monocyte inhibitory receptor HM43/HM31; leukocyte immunoglobulin-like receptor 4; leukocyte immunoglobulin-like receptor A3; e3; CD85E; LIR-4 |
Gene ID | 11026 |
mRNA Refseq | NM_006865 |
Protein Refseq | NP_006856 |
MIM | 604818 |
UniProt ID | Q8N6C8 |
◆ Recombinant Proteins | ||
LILRA3-2335R | Recombinant Rhesus Macaque LILRA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LILRA3-8597H | Recombinant Human LILRA3 protein(Met1-Glu439), hFc-tagged | +Inquiry |
LILRA3-6698H | Recombinant Human LILRA3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LILRA3-2514R | Recombinant Rhesus monkey LILRA3 Protein, His-tagged | +Inquiry |
LILRA3-6894H | Recombinant Human LILRA3 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRA3-1349HCL | Recombinant Human LILRA3 cell lysate | +Inquiry |
LILRA3-976HCL | Recombinant Human LILRA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LILRA3 Products
Required fields are marked with *
My Review for All LILRA3 Products
Required fields are marked with *
0
Inquiry Basket