Recombinant Full Length Human LILRA3 Protein, His&Fc tagged

Cat.No. : LILRA3-12HFL
Product Overview : Recombinant human LILRA3/CD85e, fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&His
Protein Length : 1-439 aa
Description : This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members of this family. It acts as a soluble receptor for class I major histocompatibility complex (MHC) antigens. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and is polymorphic in human populations, with many individuals containing a deletion of this genomic region.
Tag : C-His&Fc
Form : Liquid
Molecular Mass : 72.2 kDa
AA Sequence : < DGS> GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE< LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH>
Endotoxin : < 1 EU/μg of protein determined by LAL method
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
References : 1. Jones DC., et al, (2011) Journal of Immunology. 186:2990-2997.
2. Borges L., et al,(1997) Journal of Immunology. 159:5192-5196.
Gene Name LILRA3 leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 [ Homo sapiens (human) ]
Official Symbol LILRA3
Synonyms LILRA3; leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3; leukocyte immunoglobulin-like receptor subfamily A member 3; CD85e; HM31; HM43; ILT6; LIR 4; LIR4; ILT-6; immunoglobulin-like transcript 6; CD85 antigen-like family member E; leucocyte immunoglobulin-like receptor; monocyte inhibitory receptor HM43/HM31; leukocyte immunoglobulin-like receptor 4; leukocyte immunoglobulin-like receptor A3; e3; CD85E; LIR-4
Gene ID 11026
mRNA Refseq NM_006865
Protein Refseq NP_006856
MIM 604818
UniProt ID Q8N6C8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LILRA3 Products

Required fields are marked with *

My Review for All LILRA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon