Recombinant Full Length Human Leucine-Rich Repeat, Immunoglobulin-Like Domain And Transmembrane Domain-Containing Protein 3(Lrit3) Protein, His-Tagged
Cat.No. : | RFL35959HF |
Product Overview : | Recombinant Full Length Human Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3(LRIT3) Protein (Q3SXY7) (1-634aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-634) |
Form : | Lyophilized powder |
AA Sequence : | MDMNELPTNLPVDTVKLRIEKTVIRRISAEAFYYLVELQYLWVTYNSVASIDPSSFYNLK QLHELRLDGNSLAAFPWASLLDMPLLRTLDLHNNKITSVPNEALRYLKNLAYLDLSSNRL TTLPPDFLESWTHLVSTPSGVLDLSPSRIILGLQDNPWFCDCHISKMIELSKVVDPAIVL LDPLMTCSEPERLTGILFQRAELEHCLKPSVMTSATKIMSALGSNVLLRCDATGFPTPQI TWTRSDSSPVNYTVIQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVVTVTV LGITTTPIPPDTSERTGDHPEWDVQPGSGRSTSVSSASSYLWSSSFSPTSSFSASTLSPP STASFSLSPFSSSTVSSTTTLSTSISASTTMANKRSFQLHQGGKRNLKVAKNGSKLPPAS TSKKEELALLDQTMLTETNAAIENLRVVSETKESVTLTWNMINTTHNSAVTVLYSKYGGK DLLLLNADSSKNQVTIDGLEPGGQYMACVCPKGVPPQKDQCITFSTERVEGDDSQWSLLL VVTSTACVVILPLICFLLYKVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTR SHRDDSEKLLLCSRSSVESQVTFKSEGSRPEYYC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LRIT3 |
Synonyms | LRIT3; Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3 |
UniProt ID | Q3SXY7 |
◆ Recombinant Proteins | ||
GFRA2-1528C | Active Recombinant Cynomolgus GFRA2 protein, His-tagged | +Inquiry |
RFL36556YF | Recombinant Full Length Protease Rsep(Rsep) Protein, His-Tagged | +Inquiry |
HECW2-4599H | Recombinant Human HECW2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
bipD-1410B | Recombinant Burkholderia pseudomallei (strain 1710b) bipD protein, His&Myc-tagged | +Inquiry |
PNLIPRP1-4206R | Recombinant Rat PNLIPRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type III-06H | Native Human Collagen Type III | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
CKM-5305H | Native Human creatine kinase, muscle | +Inquiry |
CA6-804H | Native Human CA6 | +Inquiry |
ELANE-8236H | Native Human Neutrophil Elastase (ELA-2) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PI15-3209HCL | Recombinant Human PI15 293 Cell Lysate | +Inquiry |
Pancreas-832M | Mini pig Pancreas Membrane Lysate, Total Protein | +Inquiry |
Adrenal-453C | Cat Adrenal Lysate, Total Protein | +Inquiry |
RBP2-533HCL | Recombinant Human RBP2 lysate | +Inquiry |
PROM1-981RCL | Recombinant Rat PROM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRIT3 Products
Required fields are marked with *
My Review for All LRIT3 Products
Required fields are marked with *
0
Inquiry Basket