Recombinant Full Length Human Lem Domain-Containing Protein 1(Lemd1) Protein, His-Tagged
Cat.No. : | RFL2864HF |
Product Overview : | Recombinant Full Length Human LEM domain-containing protein 1(LEMD1) Protein (Q68G75) (1-181aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-181) |
Form : | Lyophilized powder |
AA Sequence : | MVDVKCLSDCKLQNQLEKLGFSPGPILPSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDG AQDSDDSEELNIILQGNIILSTEKSKKLKKWPEASTTKRKAVDTYCLDYKPSKGRRWAAR APSTRITYGTITKERDYCAEDQTIESWREEGFPVGLKLAVLGIFIIVVFVYLTVENKSLF G |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LEMD1 |
Synonyms | LEMD1; LEM domain-containing protein 1; Cancer/testis antigen 50; CT50; LEM domain protein 1; LEMP-1 |
UniProt ID | Q68G75 |
◆ Recombinant Proteins | ||
Lemd1-3770M | Recombinant Mouse Lemd1 Protein, Myc/DDK-tagged | +Inquiry |
LEMD1-5035M | Recombinant Mouse LEMD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL2864HF | Recombinant Full Length Human Lem Domain-Containing Protein 1(Lemd1) Protein, His-Tagged | +Inquiry |
LEMD1-9040M | Recombinant Mouse LEMD1 Protein | +Inquiry |
LEMD1-419H | Recombinant Human LEMD1 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LEMD1 Products
Required fields are marked with *
My Review for All LEMD1 Products
Required fields are marked with *
0
Inquiry Basket