Recombinant Full Length Human LCNL1 Protein, GST-tagged

• Cat.No.: LCNL1-4935HF
• Product Overview: Human FLJ45224 full-length ORF (BAC86862.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 164 amino acids
• Description: LCNL1 (Lipocalin Like 1) is a Protein Coding gene. An important paralog of this gene is LCN15.
• Molecular Mass: 44.44 kDa
• AA Sequence: MVGVVSDDQDFLDSKDTMKMAVVLVTPLGNGDLALKFGYPTPHGGCQKMDTTFTEGAVPGQFSNPAMTLSDIRVAFSDYQHFALLYLEMRKGGLRNQWLQLYGGRAAGRRPRHPRFGSGMSPLCLHQPFLHAEGGTAGSWCLWPRVPAPPCPSLPLFAPPAPSL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LCNL1 lipocalin like 1 [ Homo sapiens (human) ]
• Official Symbol: LCNL1
• Synonyms: LCNL1; lipocalin like 1; lipocalin-like 1 protein
• Gene ID: 401562
• mRNA Refseq: NM_207510
• Protein Refseq: NP_997393
• UniProt ID: Q6ZST4